PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00003776-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 360aa    MW: 39154.2 Da    PI: 8.9218
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00003776-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12e-1386130347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+  ++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  PSME_00003776-RA  86 PWTEEEHRMFLVGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 130
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.515518IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.44479135IPR017930Myb domain
SuperFamilySSF466891.12E-1781136IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-1782134IPR006447Myb domain, plants
SMARTSM007174.5E-1083133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-1185129IPR009057Homeodomain-like
PfamPF002491.5E-1086130IPR001005SANT/Myb domain
CDDcd001675.73E-986131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MSRSCSQCGH NGHNSRTCVG NGVMLFGVRL TDGPMRKSAS MSNLSNLAQY DHSDPAEVGV  60
EGFDGYVSDD FVHSSSNARE RKRGVPWTEE EHRMFLVGLQ KVGKGDWRGI SRNFVKTRTP  120
TQVASHAQKY FLRQSNMNRR RRRSSLFDIT TDTFLSLPVE EDLVPGSGNP PPFSSHLSLG  180
QNSSFPVPEG GNFAIPVTSF PVPLSHVVLP GLSVGKSQES GKQDITPMDC SENPAPSPLA  240
FTSEAAMDVS VSHPKFMDVR PPLQYRIWNP ALAFPSVEIS ASAGSKLVKP IPIIPTPPLK  300
TTESTKKVAI SSQNPVMEPS PLSLKLSEQP KRHSAFQSMT SLSSHELESQ GNISNVISVA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1014410.0BT101441.1 Picea glauca clone GQ01304_K02 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010272144.16e-85PREDICTED: transcription factor MYB1R1-like
TrEMBLB8LLJ20.0B8LLJ2_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-65MYB_related family protein